Structure of PDB 7ls2 Chain x2 Binding Site BS02

Receptor Information
>7ls2 Chain x2 (length=130) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLL
KRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEI
KPEMIGHYLGEFSITYKPVKHGRPGIGATH
Ligand information
>7ls2 Chain n2 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcagaguggcgcagcggaagcgugcugggcccauaacccagaggucgau
ggaucgaaaccauccucugcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ls2 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T136 H137
Binding residue
(residue number reindexed from 1)		T129 H130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0097371 MDM2/MDM4 family protein binding
GO:1990948 ubiquitin ligase inhibitor activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000056 ribosomal small subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0097421 liver regeneration
GO:1901798 positive regulation of signal transduction by p53 class mediator
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ls2, PDBe:7ls2, PDBj:7ls2
PDBsum7ls2
PubMed34815424
UniProtP62843|RS15_MOUSE Small ribosomal subunit protein uS19 (Gene Name=Rps15)

[Back to BioLiP]