Structure of PDB 6y69 Chain x Binding Site BS02

Receptor Information
>6y69 Chain x (length=95) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEKVTHTS
DATLHVDGGELHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH
Ligand information
>6y69 Chain w (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcaggguagcucgucuggcucauaaccagaagaucgucg
guucaaauccggcccccgcaacca
.<<<<<<..<<<<......>>>>.<<<<<.......>>>>>.....<<<<
<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y69 Tetracenomycin X inhibits translation by binding within the ribosomal exit tunnel.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		R33 L92
Binding residue
(residue number reindexed from 1)		R33 L92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0043022 ribosome binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0017148 negative regulation of translation
GO:0022611 dormancy process
GO:0044238 primary metabolic process
GO:0045900 negative regulation of translational elongation
Cellular Component
GO:0005829 cytosol
GO:0022627 cytosolic small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y69, PDBe:6y69, PDBj:6y69
PDBsum6y69
PubMed32601485
UniProtP0AFX0|HPF_ECOLI Ribosome hibernation promoting factor (Gene Name=hpf)

[Back to BioLiP]