Structure of PDB 6frk Chain x Binding Site BS02

Receptor Information
>6frk Chain x (length=374) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDNKRKMIQHAVFK
ELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWK
TCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKN
ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA
QAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDD
FEPFKTQPFISKLLGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFM
SKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGS
GVSTRDVQELLTQYTKFAQMVKKM
Ligand information
>6frk Chain t (length=11) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLLLLLLLLLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6frk Structure of a prehandover mammalian ribosomal SRP·SRP receptor targeting complex.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
L349 F355 M430
Binding residue
(residue number reindexed from 1)
L289 F295 M370
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0019003 GDP binding
GO:0030942 endoplasmic reticulum signal peptide binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
GO:0030593 neutrophil chemotaxis
GO:0030851 granulocyte differentiation
GO:0031017 exocrine pancreas development
GO:0045047 protein targeting to ER
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0016607 nuclear speck
GO:0048500 signal recognition particle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6frk, PDBe:6frk, PDBj:6frk
PDBsum6frk
PubMed29567807
UniProtP61010|SRP54_CANLF Signal recognition particle subunit SRP54 (Gene Name=SRP54)

[Back to BioLiP]