Structure of PDB 5zep Chain x Binding Site BS02

Receptor Information
>5zep Chain x (length=100) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEVVVKGRNVEVPDHFRTYVSEKLSRLERFDKTIYLFDVELDHERNRRQR
KNCQHVEITARGRGPVVRGEACADSFYTAFESAVQKLEGRLRRAKDRRKI
Ligand information
>5zep Chain w (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaagaucg
ucgguucaaauccggcccccgcaacca
.<<<<<...<<<<.........>>>>..<<<<.......>>>>......<
<<<<.......>>>>>.>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zep Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R127 R128 K129 I130
Binding residue
(residue number reindexed from 1)		R97 R98 K99 I100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0044238 primary metabolic process
GO:0045900 negative regulation of translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0022627 cytosolic small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zep, PDBe:5zep, PDBj:5zep
PDBsum5zep
PubMed30206241
UniProtA0QTK6

[Back to BioLiP]