Structure of PDB 7r72 Chain w Binding Site BS02

Receptor Information
>7r72 Chain w (length=189) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEEEQIEKDLQGLQEKQRLNVKRERRRKNEMKQKELQRMQMNMESLFNLK
TAEKTGILNDLAKGKKRMIFTMIKDKDSAADADDLESELNAMYSDYKTRR
SERDAKFRAKQARAITNLISKLKGQEGDHKLSSKARMIFNDPIFNNVEPF
DSDYDSEEEKNQTKKEKHSRDENLPDWFLEDAMNARPIK
Ligand information
>7r72 Chain G (length=19) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LSRYVKWPEYVRVQRQKKI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r72 Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution3.07 Å
Binding residue
(original residue number in PDB)
E465 L466 M469 W698
Binding residue
(residue number reindexed from 1)
E88 L89 M92 W177
Enzymatic activity
Enzyme Commision number 2.1.1.167: 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008649 rRNA methyltransferase activity
GO:0008650 rRNA (uridine-2'-O-)-methyltransferase activity
GO:0016435 rRNA (guanine) methyltransferase activity
GO:0070039 rRNA (guanosine-2'-O-)-methyltransferase activity
Biological Process
GO:0000451 rRNA 2'-O-methylation
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001510 RNA methylation
GO:0006364 rRNA processing
GO:0031167 rRNA methylation
GO:0032259 methylation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7r72, PDBe:7r72, PDBj:7r72
PDBsum7r72
PubMed36482249
UniProtP25582|SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase (Gene Name=SPB1)

[Back to BioLiP]