Structure of PDB 6enu Chain w Binding Site BS02

Receptor Information
>6enu Chain w (length=188) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGT
RVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAI
GDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTG
GKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6enu Structural Basis for Polyproline-Mediated Ribosome Stalling and Rescue by the Translation Elongation Factor EF-P.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
D145 T146 A147 G148
Binding residue
(residue number reindexed from 1)
D145 T146 A147 G148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003746 translation elongation factor activity
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006414 translational elongation
GO:0043043 peptide biosynthetic process
GO:0072344 rescue of stalled ribosome
GO:2001125 negative regulation of translational frameshifting
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6enu, PDBe:6enu, PDBj:6enu
PDBsum6enu
PubMed29100052
UniProtP0A6N4|EFP_ECOLI Elongation factor P (Gene Name=efp)

[Back to BioLiP]