Structure of PDB 5u4j Chain w Binding Site BS02

Receptor Information
>5u4j Chain w (length=47) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHGNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u4j Structural basis of co-translational quality control by ArfA and RF2 bound to ribosome.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		K8 Q10 I11 K12 D13 E17 A18 H21
Binding residue
(residue number reindexed from 1)		K7 Q9 I10 K11 D12 E16 A17 H20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0072344 rescue of stalled ribosome

View graph for
Biological Process
External links
PDB RCSB:5u4j, PDBe:5u4j, PDBj:5u4j
PDBsum5u4j
PubMed28077875
UniProtP36675|ARFA_ECOLI Alternative ribosome-rescue factor A (Gene Name=arfA)

[Back to BioLiP]