Structure of PDB 8v83 Chain v Binding Site BS02

Receptor Information
>8v83 Chain v (length=149) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVRKRKMNRSSVGKATRRNKDKQRKINIQSNPIIAANWDYSLTMAQNYKK
LGLRAKLQTPAGGKEADLSKVVKRIPLTEVVKKLEELASRPVIRKERSQS
EREEEWLEKLYKKHGDDYKKMFFDKKLNIYQQSEGDLKRRLLRWKKRNG
Ligand information
>8v83 Chain 2 (length=150) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacgcgccccuuggcagggggcaugccuguuugagcgucauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<..>><<<<<<<.<>>>>>>>>.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8v83 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
Resolution2.53 Å
Binding residue
(original residue number in PDB)		K8 R11 S12 S13 Q25
Binding residue
(residue number reindexed from 1)		K6 R9 S10 S11 Q23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v83, PDBe:8v83, PDBj:8v83
PDBsum8v83
PubMed38632236
UniProtP40007|NOP16_YEAST Nucleolar protein 16 (Gene Name=NOP16)

[Back to BioLiP]