Structure of PDB 8esr Chain v Binding Site BS02

Receptor Information
>8esr Chain v (length=161) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANPRQRNKQRSGKPRLTRRNANKKAKAKIYGNFVIQQNWDKHATLRQNYA
RLGLLATPNYVTGGVEKLYPDPTLDDVLDKEISIAPAKTEVVRQLEEEAV
KKAARQSNKMLPLSAFEHAYIQRLINKYGTEDFESMAKDVKLNSKLFNGS
KLKNLYIRMKA
Ligand information
>8esr Chain 2 (length=150) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcag
cgaaaugcgauacguaaugugaauugcagaagaaucaucgaaucuuugaa
cgcacugcgccuuuggguucuaccaaaggcaugccuguuugagugucauu
..........................................<<<<<<.<
<.....>>>.....(.<<<......>>........>>>..)...>>>...
.<<...>><<<<<<<<......>>>>>>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8esr Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q10 R11 S12 K14 P15 K24
Binding residue
(residue number reindexed from 1)		Q9 R10 S11 K13 P14 K23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8esr, PDBe:8esr, PDBj:8esr
PDBsum8esr
PubMed36423630
UniProtQ9Y7Z1|NOP16_SCHPO Nucleolar protein 16 (Gene Name=nop16)

[Back to BioLiP]