Structure of PDB 7pir Chain v Binding Site BS02

Receptor Information
>7pir Chain v (length=63) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKKDQLTLRGPLYGNNRSHSKTITRRKWNVNLQPCKVKTADGKTTRILVS
TRTLRTLKKHNRL
Ligand information
>7pir Chain 8 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucuuguagcucagucgguagagcaacggucugaagaaccgugugucgg
caguucgauucugcccgagaccacca
<<<..<<..<<<<........>>>>..<<<<.......>>>>......<<
<<<.......>>>>>>>..>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution12.1 Å
Binding residue
(original residue number in PDB)		S19 H20 S21 K22
Binding residue
(residue number reindexed from 1)		S18 H19 S20 K21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum7pir
PubMed36171285
UniProtP75171|RL28_MYCPN Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]