Structure of PDB 7paq Chain v Binding Site BS02

Receptor Information
>7paq Chain v (length=63) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKKDQLTLRGPLYGNNRSHSKTITRRKWNVNLQPCKVKTADGKTTRILVS
TRTLRTLKKHNRL
Ligand information
>7paq Chain 8 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucuuguagcucagucgguagagcaacggucugaagaaccgugugucgg
caguucgauucugcccgagaccacca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7paq Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution8.9 Å
Binding residue
(original residue number in PDB)		N16 N17 R18 S19 H20 S21 K22 T23 I24 T25
Binding residue
(residue number reindexed from 1)		N15 N16 R17 S18 H19 S20 K21 T22 I23 T24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7paq, PDBe:7paq, PDBj:7paq
PDBsum7paq
PubMed36171285
UniProtP75171|RL28_MYCPN Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]