Structure of PDB 7ohs Chain v Binding Site BS02

Receptor Information

>7ohs Chain v (length=130) Species: 559292 (Saccharomyces cerevisiae S288C)

SVRKRKMNRSSVGKATRRNKDKQRKINIQSNPIIAANWDYSLTMAQNYKK
LGLRAKLQTPAGGKETEVVKKLEELASRSQSEREEEWLEKLYKKHGDDYK
KMFFDKKLNIYQQSEGDLKRRLLRWKKRNG

Ligand information

>7ohs Chain 2 (length=147)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacgccccuugcagggggcaugccuguuugagcgucauuu

.........................................<<<<<<.<<
.....>>>.....(.<<<(.....>>............).>>>..)...>
>>........<<<<<<....>>>>>>.....................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Resolution: 4.38 Å
• Binding residue (original residue number in PDB): K8 R11 S12 Q25
• Binding residue (residue number reindexed from 1): K6 R9 S10 Q23

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding

Biological Process

• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
• PDBsum: 7ohs
• PubMed: 34813592
• UniProt: P40007|NOP16_YEAST Nucleolar protein 16 (Gene Name=NOP16)