Structure of PDB 6gwt Chain v Binding Site BS02

Receptor Information
>6gwt Chain v (length=248) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSASE
GEHGGYKEIIAKICGDGVYGRLKFESGGHRVQRVPATESQGRIHTSACTV
AVMPELPDAELPDINPADLRIDTFRSSGAGAQHVNTTDSAIRITHLPTGI
VVECQDERSQHKNKAKALSVLGARIHAAEMAKRQQAEASTRRNLLGSGDR
SDRNRTYNFPQGRVTDHRINLTLYRLDEVMEGKLDMLIEPIIQEHQAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gwt Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		D122 Q185 R195 I196 H197 T198
Binding residue
(residue number reindexed from 1)		D19 Q82 R92 I93 H94 T95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0016149 translation release factor activity, codon specific
Biological Process
GO:0006415 translational termination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6gwt, PDBe:6gwt, PDBj:6gwt
PDBsum6gwt
PubMed30076302
UniProtP0A7I0|RF1_ECOLI Peptide chain release factor RF1 (Gene Name=prfA)

[Back to BioLiP]