Structure of PDB 7osm Chain uL18 Binding Site BS02

Receptor Information
>7osm Chain uL18 (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>7osm Chain AB (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7osm Accuracy mechanism of eukaryotic ribosome translocation.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 T28 Y30 R33 R50 V52 R54 T56 N57 K58 Q63 I69 T70 G71 D72 V73 V74 Y79 H90 G91 N94 W95 Q151 R152 T154 T155 G156 R158 P181 Y198 H203 V204 Y207 E210 E221 F223 T256 K259 F260 K262 Y265 A266 E268 S269 K270 Y272 K276 L277 R282 V286 K289
Binding residue
(residue number reindexed from 1)		K7 S9 S12 S13 F15 T17 F19 R20 R21 R23 T27 Y29 R32 R49 V51 R53 T55 N56 K57 Q62 I68 T69 G70 D71 V72 V73 Y78 H89 G90 N93 W94 Q150 R151 T153 T154 G155 R157 P180 Y197 H202 V203 Y206 E209 E220 F222 T255 K258 F259 K261 Y264 A265 E267 S268 K269 Y271 K275 L276 R281 V285 K288
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 22:35:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7osm', asym_id = 'uL18', bs = 'BS02', title = 'Accuracy mechanism of eukaryotic ribosome translocation.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7osm', asym_id='uL18', bs='BS02', title='Accuracy mechanism of eukaryotic ribosome translocation.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '7osm', asym_id = 'uL18'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='7osm', asym_id='uL18')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>