Structure of PDB 7osa Chain uL18 Binding Site BS02

Receptor Information
>7osa Chain uL18 (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>7osa Chain AB (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7osa Accuracy mechanism of eukaryotic ribosome translocation.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		A2 F3 K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 K27 Y30 R33 R50 R54 T56 N57 K58 Q63 I69 T70 G71 D72 V73 V74 G91 N94 W95 Q151 R152 T154 T155 A157 R158 P181 Y198 H203 Q206 Y207 R218 E221 L222 K224 Y226 F253 T256 K259 F260 Y265 A266 E268 S269 Y272 R273 Q274 K276 L277 K279 R282 R285
Binding residue
(residue number reindexed from 1)		A1 F2 K7 S9 S12 S13 F15 T17 F19 R20 R21 R23 K26 Y29 R32 R49 R53 T55 N56 K57 Q62 I68 T69 G70 D71 V72 V73 G90 N93 W94 Q150 R151 T153 T154 A156 R157 P180 Y197 H202 Q205 Y206 R217 E220 L221 K223 Y225 F252 T255 K258 F259 Y264 A265 E267 S268 Y271 R272 Q273 K275 L276 K278 R281 R284
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Feb 21 00:06:36 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7osa', asym_id = 'uL18', bs = 'BS02', title = 'Accuracy mechanism of eukaryotic ribosome translocation.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7osa', asym_id='uL18', bs='BS02', title='Accuracy mechanism of eukaryotic ribosome translocation.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '7osa', asym_id = 'uL18'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='7osa', asym_id='uL18')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>