Structure of PDB 8v83 Chain u Binding Site BS02

Receptor Information

>8v83 Chain u (length=112) Species: 1247190 (Saccharomyces cerevisiae BY4741)

MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLK
WTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIR
QKRERAFYKNRM

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8v83 Chain u Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8v83 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
• Resolution: 2.53 Å
• Binding residue (original residue number in PDB): C6 C32 C36
• Binding residue (residue number reindexed from 1): C6 C32 C36
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0001671 ATPase activator activity
• GO:0051117 ATPase binding

Biological Process

• GO:0032781 positive regulation of ATP-dependent activity
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis
• GO:1902626 assembly of large subunit precursor of preribosome

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:8v83, PDBe:8v83, PDBj:8v83
• PDBsum: 8v83
• PubMed: 38632236
• UniProt: Q07915|RLP24_YEAST Ribosome biogenesis protein RLP24 (Gene Name=RLP24)