Structure of PDB 7pir Chain u Binding Site BS02

Receptor Information
>7pir Chain u (length=86) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKKGVGSTKNGRDSHAKRLGAKKADGQMIRTGQIIYRQRGTRVYPGVNVG
LGSDDTLFALSDGLVKYQKFGPKQGKTRVSVVKHKL
Ligand information
>7pir Chain 4 (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuggugcccaugucgcuguggaaacaccugguuccauuucgaacccagc
aguuaagcacaguggagccgaauguagcugcagugagaauaggaaagcac
caagc
.<.<<<<......<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<......................>>....>>>
>.>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution12.1 Å
Binding residue
(original residue number in PDB)		K85 F86 G87 P88 K89 Q90
Binding residue
(residue number reindexed from 1)		K69 F70 G71 P72 K73 Q74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum7pir
PubMed36171285
UniProtP75458|RL27_MYCPN Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]