Structure of PDB 7phb Chain u Binding Site BS02

Receptor Information
>7phb Chain u (length=86) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKKGVGSTKNGRDSHAKRLGAKKADGQMIRTGQIIYRQRGTRVYPGVNVG
LGSDDTLFALSDGLVKYQKFGPKQGKTRVSVVKHKL
Ligand information
>7phb Chain 4 (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuggugcccaugucgcuguggaaacaccugguuccauuucgaacccagc
aguuaagcacaguggagccgaauguagcugcagugagaauaggaaagcac
caagc
<<<<<<<<.....<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<..<....<<<..>>>.....>.>>...>>>>
>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7phb Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		G87 P88
Binding residue
(residue number reindexed from 1)		G71 P72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7phb, PDBe:7phb, PDBj:7phb
PDBsum7phb
PubMed36171285
UniProtP75458|RL27_MYCPN Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]