Structure of PDB 7ohs Chain u Binding Site BS02

Receptor Information

>7ohs Chain u (length=116) Species: 559292 (Saccharomyces cerevisiae S288C)

MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLK
WTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIR
QKRERAFYKNRMRGNK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7ohs Chain u Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Resolution: 4.38 Å
• Binding residue (original residue number in PDB): C9 C32
• Binding residue (residue number reindexed from 1): C9 C32
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0001671 ATPase activator activity
• GO:0051117 ATPase binding

Biological Process

• GO:0032781 positive regulation of ATP-dependent activity
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis
• GO:1902626 assembly of large subunit precursor of preribosome

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
• PDBsum: 7ohs
• PubMed: 34813592
• UniProt: Q07915|RLP24_YEAST Ribosome biogenesis protein RLP24 (Gene Name=RLP24)