Structure of PDB 7nad Chain u Binding Site BS02

Receptor Information
>7nad Chain u (length=56) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RNPRKLKWTKAFRKAAGKELAERAFYKNRMRGNKEKDFLRDKKLVESNPE
LLRIRE
Ligand information
>7nad Chain B (length=9) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FMGTLKKDL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nad Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution3.04 Å
Binding residue
(original residue number in PDB)		K53 R105 Y108 K109
Binding residue
(residue number reindexed from 1)		K10 R23 Y26 K27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001671 ATPase activator activity
GO:0051117 ATPase binding
Biological Process
GO:0032781 positive regulation of ATP-dependent activity
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nad, PDBe:7nad, PDBj:7nad
PDBsum7nad
PubMed36482249
UniProtQ07915|RLP24_YEAST Ribosome biogenesis protein RLP24 (Gene Name=RLP24)

[Back to BioLiP]