Structure of PDB 6yly Chain u Binding Site BS02

Receptor Information

>6yly Chain u (length=137) Species: 4932 (Saccharomyces cerevisiae)

MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLK
WTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIR
QKRERAFYKNRMRGNKEKDFLRDKKLVESNPELLRIR

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 6yly Chain u Residue 200

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6yly Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): C9 R33 C36
• Binding residue (residue number reindexed from 1): C9 R33 C36
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0001671 ATPase activator activity
• GO:0051117 ATPase binding

Biological Process

• GO:0032781 positive regulation of ATP-dependent activity
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis
• GO:1902626 assembly of large subunit precursor of preribosome

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:6yly, PDBe:6yly, PDBj:6yly
• PDBsum: 6yly
• PubMed: 32668200
• UniProt: Q07915|RLP24_YEAST Ribosome biogenesis protein RLP24 (Gene Name=RLP24)