Structure of PDB 8wid Chain t Binding Site BS02

Receptor Information
>8wid Chain t (length=82) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAV
HDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGH
Ligand information
>8wid Chain x (length=11) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRVARFEKRYG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wid Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		L5 G8 P9 P42 E64 A65 V67
Binding residue
(residue number reindexed from 1)		L4 G7 P8 P41 E63 A64 V66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wid, PDBe:8wid, PDBj:8wid
PDBsum8wid
PubMed38245551
UniProtA0QSD5|RS19_MYCS2 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]