Structure of PDB 8v83 Chain t Binding Site BS02

Receptor Information
>8v83 Chain t (length=249) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKFVRAESIVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILK
ITEGLIREKTTYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNT
GVFVKLTKNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAE
PHEIVLNDNNIVEEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKL
NREVSGFGSLNRLRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN
Ligand information
>8v83 Chain 6 (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauguuugguagugagugauacucgaguuaacuugaaauu
gccuuaaa
......<<<<<..>>>>>.....<<<<.<.<<<..>>>>.>>>>......
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8v83 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
Resolution2.53 Å
Binding residue
(original residue number in PDB)		E59 L66 R70 R77 H92 I93 A94 K97 K132 R146 R148 G149 V153 T171 R275 S278 G279 F280 R292 F301 S302 N303 A304
Binding residue
(residue number reindexed from 1)		E7 L14 R18 R25 H40 I41 A42 K45 K59 R73 R75 G76 V80 T98 R202 S205 G206 F207 R219 F228 S229 N230 A231
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v83, PDBe:8v83, PDBj:8v83
PDBsum8v83
PubMed38632236
UniProtP40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)

[Back to BioLiP]