Structure of PDB 7q0f Chain t Binding Site BS02

Receptor Information

>7q0f Chain t (length=200) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AISKNLPLLNNHFRKHWQERVRVHFDQAGKKASRRQSRLRKAAKIAPRPI
DALRPVVRAPTVKYNRKVRAGRGFTLAELKAVGIAPKYARTIGISVDHRR
QNKSQETFDANVARLQEYKSKLVIFDKKTKASEVASFEQVDVSATFPVEQ
PAPESGLRAVEVPEQTAYRTLRLARNEKKYKGIREKRAKEKAEAEAEKAK

Ligand information

>7q0f Chain 4 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguuu

.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.
Resolution	2.64 Å
Binding residue (original residue number in PDB)	F26 D27
Binding residue (residue number reindexed from 1)	F25 D26

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0009986	cell surface
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
PDBsum	7q0f
PubMed	35613268
UniProt	O59931\|RL13_CANAL Large ribosomal subunit protein eL13 (Gene Name=RPL13)

[Back to BioLiP]