Structure of PDB 7ohs Chain t Binding Site BS02

Receptor Information
>7ohs Chain t (length=244) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKFVRAESIVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILK
ITEGLIREKTTYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNT
GVFVKLTKNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAE
PHEIVLNDNNIVEEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKL
NREVSGFGSLNRLRKIKQREAESRTRQFSNAATAPVIEVDIDSL
Ligand information
>7ohs Chain 6 (length=65) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa
......<<<<<<...>>>>>>.....<<<<...<<<<....>>>>..>>>
>..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Resolution4.38 Å
Binding residue
(original residue number in PDB)		K54 E59 S60 A63 R70 R77 H92 I93 A94 S95 K97 F99 R146 R148 G149 P150 L151 V153 F160 V169 T171 R275 S278 G279 F280 R292 N303 A304
Binding residue
(residue number reindexed from 1)		K2 E7 S8 A11 R18 R25 H40 I41 A42 S43 K45 F47 R73 R75 G76 P77 L78 V80 F87 V96 T98 R202 S205 G206 F207 R219 N230 A231
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
PDBsum7ohs
PubMed34813592
UniProtP40693|RLP7_YEAST Ribosome biogenesis protein RLP7 (Gene Name=RLP7)

[Back to BioLiP]