Structure of PDB 8hfr Chain sm Binding Site BS02

Receptor Information
>8hfr Chain sm (length=150) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPKGRKYEKLVRATMREDKIAAKKKLHQDKRVHELARVKFMQDVVNSDTF
KGQPIFDHAHTREFIQSFIERDDTELDELKKKRRSNRPPSNRQVLLQQRR
DQELKEFKAGFLCPDLSDAKNMEFLRNWNGTFGLLNTLRLIRINDKGEQV
Ligand information
>8hfr Chain 2f (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hfr Nuclear export of pre-60S particles through the nuclear pore complex.
Resolution2.64 Å
Binding residue
(original residue number in PDB)		R35 R39 K42 H50 L158 N159 T160
Binding residue
(residue number reindexed from 1)		R12 R16 K19 H27 L135 N136 T137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hfr, PDBe:8hfr, PDBj:8hfr
PDBsum8hfr
PubMed37258668
UniProtQ08687|TMA16_YEAST Translation machinery-associated protein 16 (Gene Name=TMA16)

[Back to BioLiP]