Structure of PDB 8q5i Chain s Binding Site BS02

Receptor Information

>8q5i Chain s (length=172) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDKSQNVMRELRIEKLVLNICVGESGDRLTRAAKVLEQLSGQTPVQSKAR
YTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRSKNFSATGN
FGFGIDEHIDLGIKYDPSIGIYGMDFYVVMGRAGARVTRRKRARSTIGNS
HKTNKEDTIQWFKTRYDAEVLD

Ligand information

>8q5i Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuagcagaaagcaccguuccccguucgaucaaccgu
aguuaagcugcuaagagcaauaccgaguaguguagugggagaccauacgc
gaaacuauugugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
Resolution	2.45 Å
Binding residue (original residue number in PDB)	S2 D3 K4 N7 M9 R10 Q43 T44 V46 T70 R72 G135 R137 R141 R143 S146 T147 G149 N150 H152
Binding residue (residue number reindexed from 1)	S1 D2 K3 N6 M8 R9 Q42 T43 V45 T69 R71 G134 R136 R140 R142 S145 T146 G148 N149 H151

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	A0A8H6F1S5

[Back to BioLiP]