Structure of PDB 7pzy Chain s Binding Site BS02

Receptor Information
>7pzy Chain s (length=172) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDKSQNVMRELRIEKLVLNICVGESGDRLTRAAKVLEQLSGQTPVQSKAR
YTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRSKNFSATGN
FGFGIDEHIDLGIKYDPSIGIYGMDFYVVMGRAGARVTRRKRARSTIGNS
HKTNKEDTIQWFKTRYDAEVLD
Ligand information
>7pzy Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuagcagaaagcaccguuccccguucgaucaaccgu
aguuaagcugcuaagagcaauaccgaguaguguagugggagaccauacgc
gaaacuauugugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pzy E-site drug specificity of the human pathogen Candida albicans ribosome.
Resolution2.32 Å
Binding residue
(original residue number in PDB)
S2 D3 K4 N7 M9 R10 Q43 T44 V46 V69 T70 R72 G135 R137 R141 R143 S146 T147 G149 N150 H152
Binding residue
(residue number reindexed from 1)
S1 D2 K3 N6 M8 R9 Q42 T43 V45 V68 T69 R71 G134 R136 R140 R142 S145 T146 G148 N149 H151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7pzy, PDBe:7pzy, PDBj:7pzy
PDBsum7pzy
PubMed35613268
UniProtA0A1D8PHW1|RL11_CANAL Large ribosomal subunit protein uL5 (Gene Name=RPL11)

[Back to BioLiP]