Structure of PDB 6r87 Chain s Binding Site BS02

Receptor Information

>6r87 Chain s (length=220) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAAQA

Ligand information

>6r87 Chain B (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggcguguggcguagucgguagcgcgcucccuuagcaugggagaggucuc
cgguucgauuccggacucguccgcca

<<<<<....<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>..>>>>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6r87 Structure and function of Vms1 and Arb1 in RQC and mitochondrial proteome homeostasis.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	C104 A105 G106 D108
Binding residue (residue number reindexed from 1)	C104 A105 G106 D108

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6r87, PDBe:6r87, PDBj:6r87
PDBsum	6r87
PubMed	31189955
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]