Structure of PDB 5tbw Chain s Binding Site BS02

Receptor Information

>5tbw Chain s (length=169) Species: 559292 (Saccharomyces cerevisiae S288C)

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

Ligand information

>5tbw Chain 3 (length=121)

gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5tbw Synthesis facilitates an understanding of the structural basis for translation inhibition by the lissoclimides.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): M9 Q43 T44 V46 V69 T70 R72 G135 R137 V138 R141 K142 R143 V148 G149 H152
• Binding residue (residue number reindexed from 1): M4 Q38 T39 V41 V64 T65 R67 G130 R132 V133 R136 K137 R138 V143 G144 H147

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tbw, PDBe:5tbw, PDBj:5tbw
• PDBsum: 5tbw
• PubMed: 29064494
• UniProt: Q3E757|RL11B_YEAST Large ribosomal subunit protein uL5B (Gene Name=RPL11B)