Structure of PDB 7q0r Chain r Binding Site BS02

Receptor Information

>7q0r Chain r (length=208) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARRPARCYRYCKNKPYPKSRYNRAVPDAKIRIYDLGRKKATVDEFPLCIH
LVSNELEQLSSEALEAARICANKYITKVSGRDSFHLRVRVHPFHVLRINK
MQGMRGAWGKPHGLAARVSIGQIIMSARTKDSNKDVVIEGLRRARYKFPG
QQKIIISKKWGFTPLNRDEYIAKKTNGEVIDDGAYVKFLSRKGNLEANLQ
QFPNYQYS

Ligand information

>7q0r Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuagcagaaagcaccguuccccguucgaucaaccgu
aguuaagcugcuaagagcaauaccgaguaguguagugggagaccauacgc
gaaacuauugugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7q0r E-site drug specificity of the human pathogen Candida albicans ribosome.
Resolution	2.67 Å
Binding residue (original residue number in PDB)	Y11 L57 R202 K203 G204 L206 Y216
Binding residue (residue number reindexed from 1)	Y10 L56 R191 K192 G193 L195 Y205

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0009986	cell surface
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q0r, PDBe:7q0r, PDBj:7q0r
PDBsum	7q0r
PubMed	35613268
UniProt	Q5AIB8\|RL10_CANAL Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]