Structure of PDB 7pkt Chain r Binding Site BS02

Receptor Information
>7pkt Chain r (length=158) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQETRLRFVSSEWRSGRPQPPERRIPICFPNITLQMMKLTPEQMDQVKET
GWLREVAFKTTPDVTKLEIAAFLQSVYGMNVERVSTINYLGRRRLAISRN
GKRLWWREDDWKKAYVIFRPPAGQEHLLTRQQRPVIEQIREAARAPRLPP
RPYPWERR
Ligand information
>7pkt Chain 6 (length=136) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agucauagguagcagaacguucuggaacaauuacgcugaaaacaguaaca
gaauugaagcugcuaacauaaguaacacuaaauggauaacauggccguaa
gcccaagguuuugcauaacaaacagugaauacgguu
...................<<<<<............<<....>>....>>
>>>............................<<<.....>>>........
...........<<.........>>............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K95 S114 I116 Y118 R121 R122 R123 K142 Y144 P189 R190 P192 P193 R194 Y196 P197 W198 E199 R200 R201
Binding residue
(residue number reindexed from 1)		K66 S85 I87 Y89 R92 R93 R94 K113 Y115 P146 R147 P149 P150 R151 Y153 P154 W155 E156 R157 R158
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 08:52:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7pkt', asym_id = 'r', bs = 'BS02', title = 'How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7pkt', asym_id='r', bs='BS02', title='How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7pkt', asym_id = 'r'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7pkt', asym_id='r')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>