Structure of PDB 7of3 Chain r Binding Site BS02

Receptor Information

>7of3 Chain r (length=146) Species: 9606 (Homo sapiens)

FREVVETTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLL
SQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRQLNRY
LTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7of3 Chain r Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7of3 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): Q69 C70
• Binding residue (residue number reindexed from 1): Q30 C31
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7of3, PDBe:7of3, PDBj:7of3
• PDBsum: 7of3
• PubMed: 34135319
• UniProt: Q9NVS2|RT18A_HUMAN Large ribosomal subunit protein mL66 (Gene Name=MRPS18A)