Structure of PDB 5imq Chain r Binding Site BS02

Receptor Information

>5imq Chain r (length=180) Species: 300852 (Thermus thermophilus HB8)

MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSL
HASDLKLPPGVELAVSPEETIAAVVPPEDV

Ligand information

>5imq Chain E (length=123)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau

..<<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<...<.<.<<<<<<<<....>>>>>>>>
...>.>.>>>.>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): R10 E11 E13 R19 V27 Y29 R31 H32 K36 Y38 R72 Q73 R79 H85 D87 F89
• Binding residue (residue number reindexed from 1): R10 E11 E13 R19 V27 Y29 R31 H32 K36 Y38 R72 Q73 R79 H85 D87 F89

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5imq, PDBe:5imq, PDBj:5imq
• PDBsum: 5imq
• PubMed: 27137929
• UniProt: Q5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)