Structure of PDB 8ch6 Chain q Binding Site BS02

Receptor Information
>8ch6 Chain q (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYNGIGLPTPRGSGTNGYVQRNLSLVRNPDILDHERKRRVELRCLELEEM
MEEQGYEEQQIQEKVATFRLMLLE
Ligand information
>8ch6 Chain g (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucggccuccgaacgguaagagccuagcauguagaacugguuaugauguca
uacuuauccugucccuuuuuuuucca
..................................................
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ch6 Structural basis of catalytic activation in human splicing.
Resolution5.9 Å
Binding residue
(original residue number in PDB)		Y2 P10 G14 T15 N16 Y18 V19 R21 R27
Binding residue
(residue number reindexed from 1)		Y2 P10 G14 T15 N16 Y18 V19 R21 R27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0070742 C2H2 zinc finger domain binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ch6, PDBe:8ch6, PDBj:8ch6
PDBsum8ch6
PubMed37165190
UniProtQ9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 (Gene Name=SRRM2)

[Back to BioLiP]