Structure of PDB 7uqz Chain q Binding Site BS02

Receptor Information
>7uqz Chain q (length=156) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKSTTSWSTASVRPSTLDIEPIAVKEFTEIPHAGKSYNPNNKAWSELINK
EYKEEKAREDERIALEKYKERIRHLMETLKKHKLGTKYSVIDERLEIKFS
DELSDSLRKLKPEGNLLYDTVRKLQSSGKVETRVPVRKGRKYKQKITEKW
THKDFK
Ligand information
>7uqz Chain 2 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Resolution2.44 Å
Binding residue
(original residue number in PDB)		K192 S193 T195 S196 S198 T199 A200 V202 T206 K448 W449
Binding residue
(residue number reindexed from 1)		K2 S3 T5 S6 S8 T9 A10 V12 T16 K149 W150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0000460 maturation of 5.8S rRNA
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
PDBsum7uqz
PubMed36864048
UniProtQ12080|NOP53_YEAST Ribosome biogenesis protein NOP53 (Gene Name=NOP53)

[Back to BioLiP]