Structure of PDB 5gak Chain q Binding Site BS02

Receptor Information
>5gak Chain q (length=154) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHG
HAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLM
NMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEA
ARTD
Ligand information
>5gak Chain B (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagcgguaguucagucgguuagaauaccugccugucacgcagggggucg
cggguucgagucccguccguuccgcca
<<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gak Structure of the hypusinylated eukaryotic translation factor eIF-5A bound to the ribosome.
Resolution3.88 Å
Binding residue
(original residue number in PDB)		R27 F31 X51 R87 K151
Binding residue
(residue number reindexed from 1)		R24 F28 X48 R84 K148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0003746 translation elongation factor activity
GO:0005515 protein binding
GO:0043022 ribosome binding
Biological Process
GO:0002182 cytoplasmic translational elongation
GO:0002184 cytoplasmic translational termination
GO:0006412 translation
GO:0006413 translational initiation
GO:0006414 translational elongation
GO:0006452 translational frameshifting
GO:0045901 positive regulation of translational elongation
GO:0045905 positive regulation of translational termination
GO:0045948 positive regulation of translational initiation
GO:0072344 rescue of stalled ribosome
GO:0097622 cytoplasmic translational elongation through polyproline stretches
GO:0140708 CAT tailing
GO:1903272 positive regulation of cytoplasmic translational elongation through polyproline stretches
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gak, PDBe:5gak, PDBj:5gak
PDBsum5gak
PubMed26715760
UniProtP23301|IF5A1_YEAST Eukaryotic translation initiation factor 5A-1 (Gene Name=HYP2)

[Back to BioLiP]