Structure of PDB 3jct Chain q Binding Site BS02

Receptor Information
>3jct Chain q (length=183) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKVKLPSGIKLDVEKKDQIPEELLKKSTTSWSTASVRPSTLDIEPIAVKE
FTEIPHAGKSYNPNNKAWSELINKEYKEEKAREDERIALEKYKERIRHLM
ETLDDNKKHKLGTKYSVIDERLEIKFSDELSDSLRKLKPEGNLLYDTVRK
LQSSGKVETRVPVRKGRKYKQKITEKWTHKDFK
Ligand information
>3jct Chain 2 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes
Resolution3.08 Å
Binding residue
(original residue number in PDB)		S193 T194 T195 S196 W197 S198 A200 S201 V202 S205 T206 K448 W449
Binding residue
(residue number reindexed from 1)		S27 T28 T29 S30 W31 S32 A34 S35 V36 S39 T40 K176 W177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0000460 maturation of 5.8S rRNA
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jct, PDBe:3jct, PDBj:3jct
PDBsum3jct
PubMed27251291
UniProtQ12080|NOP53_YEAST Ribosome biogenesis protein NOP53 (Gene Name=NOP53)

[Back to BioLiP]