Structure of PDB 5fcj Chain o9 Binding Site BS02

Receptor Information

>5fcj Chain o9 (length=50) Species: 559292 (Saccharomyces cerevisiae S288C)

AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI

Ligand information

>5fcj Chain 8 (length=158)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5fcj Crystal Structures of the uL3 Mutant Ribosome: Illustration of the Importance of Ribosomal Proteins for Translation Efficiency.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): F7 R8 K12 K15 K18 Q19 R21 L23 P24 W26 I27 L29 R30 T31 I35 K40
• Binding residue (residue number reindexed from 1): F6 R7 K11 K14 K17 Q18 R20 L22 P23 W25 I26 L28 R29 T30 I34 K39

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5fcj, PDBe:5fcj, PDBj:5fcj
• PDBsum: 5fcj
• PubMed: 26906928
• UniProt: P04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)