Structure of PDB 7pwo Chain o2 Binding Site BS02

Receptor Information
>7pwo Chain o2 (length=94) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTYPAERRTFCKREGKHTVHKASLYKKGKDSLLAQGKRRYDRKQRGFGGQ
TKPIFRRKAKTTKKQVIRLTCSSCKCQTFQVLKRCHRLEISRLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pwo Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		G37 Y41 P54 F56
Binding residue
(residue number reindexed from 1)		G36 Y40 P53 F55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pwo, PDBe:7pwo, PDBj:7pwo
PDBsum7pwo
PubMed35100413
UniProtA8BQU8

[Back to BioLiP]