Structure of PDB 6gqb Chain o Binding Site BS02

Receptor Information
>6gqb Chain o (length=105) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF
Ligand information
>6gqb Chain AX (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcggauuuagcucaguugggagagcgccagacugaagaucuggagguccu
guguucgauccacagaauucgcacca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gqb Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		K29 G39 K40 Y43 P56 V57 F58
Binding residue
(residue number reindexed from 1)		K28 G38 K39 Y42 P55 V56 F57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
GO:0046898 response to cycloheximide
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gqb, PDBe:6gqb, PDBj:6gqb
PDBsum6gqb
PubMed29886014
UniProtP0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)

[Back to BioLiP]