Structure of PDB 8crx Chain n Binding Site BS02

Receptor Information
>8crx Chain n (length=126) Species: 1747 (Cutibacterium acnes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASTLTVRKSLSDRAKARARRQARGRKKIFGTVERPRMVVTRSSKHVFVQV
IDDVAGNTLVSASTMEAELREMSGDKTAKAARVGTIIGERAKAAGITKVV
FDKAGNQYHGRIAALADAAREAGLDF
Ligand information
>8crx Chain b (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuccgguggccauaguggaagggaaacacccggucccauuccgaacccg
gucguuaagccuuccaacgcugaugguacugcacgagggaucguguggga
gaguaagacgcugccggaau
.<<<<<<<<<<....<<<<<<<<.....<<<<<...............>>
>..>>....>>>>>>.>>.<<.......<<<<<<<<....>>>>>>>>..
.....>>..>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8crx Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
Resolution2.78 Å
Binding residue
(original residue number in PDB)		A2 S3 L5 R8 K9 S10 L11 S12 R14 Q22 R26 R37 T41 R42 S43 S44 K45 H46 F48 Q50 G57 N58 T59 S62 M66 R71 D76 K77 T78 Q108 H110 G111 R112
Binding residue
(residue number reindexed from 1)		A1 S2 L4 R7 K8 S9 L10 S11 R13 Q21 R25 R36 T40 R41 S42 S43 K44 H45 F47 Q49 G56 N57 T58 S61 M65 R70 D75 K76 T77 Q107 H109 G110 R111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8crx, PDBe:8crx, PDBj:8crx
PDBsum8crx
PubMed36864821
UniProtA0A2B7JN02

[Back to BioLiP]