Structure of PDB 8azw Chain n Binding Site BS02

Receptor Information

>8azw Chain n (length=122) Species: 4097 (Nicotiana tabacum)

ARIKVHELRNKTKTELLAQLKDLKAELALLRVAKVTGGAPNKLSKIKVVR
LSIAQVLTVISQKQKTALREAYKNKKYLPLDLRPKKTRAIRKRLTKHQVS
LKTEREKKKEMYFPIRKYAIKV

Ligand information

>8azw Chain B (length=163)

aaacgacucucggcaacggauaucucggcucucgcaucgaugaagaacgu
agcgaaaugcgauacuuggugugaauugcagaauuccgugaaccaucgag
ucuuugaacgcaaguugcgcccgaagccauuaggccgagggcacgucugc
cugggcgucacgc

............................................<<<<<<
.((.....>>>....<<<<<<<.....))............>.>>>>.>>
..>>>....<<.....>><<<<...<<......>>...>>>>........
.............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
• Resolution: 2.14 Å
• Binding residue (original residue number in PDB): R3 V6 H7 R10 N42 S45 K48 A55 Q56 L58 T59 S62 Q63 K66 R84 P85 K86 T88 R89 R92
• Binding residue (residue number reindexed from 1): R2 V5 H6 R9 N41 S44 K47 A54 Q55 L57 T58 S61 Q62 K65 R83 P84 K85 T87 R88 R91

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8azw, PDBe:8azw, PDBj:8azw
• PDBsum: 8azw
• PubMed: 37156858
• UniProt: A0A1S3WY31