Structure of PDB 7pir Chain n Binding Site BS02

Receptor Information

>7pir Chain n (length=112) Species: 272634 (Mycoplasmoides pneumoniae M129)

MKTRTEQRRLRHKRIVKKIRATNHDNRVVLMVIKSLNHISVQAWDFSQNI
VLASSSSLALKLKNNAKLVGQDIADKLVKLKLTNVVFDTGGSKYHGRIAA
LAEAARERGLNF

Ligand information

>7pir Chain 4 (length=105)

uuuggugcccaugucgcuguggaaacaccugguuccauuucgaacccagc
aguuaagcacaguggagccgaauguagcugcagugagaauaggaaagcac
caagc

.<.<<<<......<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<......................>>....>>>
>.>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Resolution: 12.1 Å
• Binding residue (original residue number in PDB): T3 R4 T5 R8 R11 M31 K34 S35 L36 N37 H38 Q42 W44 N49 I50 V51 S57 L58 K63 N64 N69 G95 S96 H99 G100 R101
• Binding residue (residue number reindexed from 1): T3 R4 T5 R8 R11 M31 K34 S35 L36 N37 H38 Q42 W44 N49 I50 V51 S57 L58 K63 N64 N65 G91 S92 H95 G96 R97

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: Q50302|RL18_MYCPN Large ribosomal subunit protein uL18 (Gene Name=rplR)