Structure of PDB 7pip Chain n Binding Site BS02

Receptor Information

>7pip Chain n (length=112) Species: 272634 (Mycoplasmoides pneumoniae M129)

MKTRTEQRRLRHKRIVKKIRATNHDNRVVLMVIKSLNHISVQAWDFSQNI
VLASSSSLALKLKNNAKLVGQDIADKLVKLKLTNVVFDTGGSKYHGRIAA
LAEAARERGLNF

Ligand information

>7pip Chain 4 (length=105)

uuuggugcccaugucgcuguggaaacaccugguuccauuucgaacccagc
aguuaagcacaguggagccgaauguagcugcagugagaauaggaaagcac
caagc

<<<<<<<......<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<.......<<....>>.......>>....>>>
>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7pip Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Resolution: 9.3 Å
• Binding residue (original residue number in PDB): T3 R4 T5 R9 R11 R20 K34 S35 L36 N37 W44 N49 I50 V51 S54 L58 K63 N64 N69 S96 K97 H99 R101
• Binding residue (residue number reindexed from 1): T3 R4 T5 R9 R11 R20 K34 S35 L36 N37 W44 N49 I50 V51 S54 L58 K63 N64 N65 S92 K93 H95 R97

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pip, PDBe:7pip, PDBj:7pip
• PDBsum: 7pip
• PubMed: 36171285
• UniProt: Q50302|RL18_MYCPN Large ribosomal subunit protein uL18 (Gene Name=rplR)