Structure of PDB 7p6z Chain n Binding Site BS02

Receptor Information
>7p6z Chain n (length=112) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTRTEQRRLRHKRIVKKIRATNHDNRVVLMVIKSLNHISVQAWDFSQNI
VLASSSSLALKLKNNAKLVGQDIADKLVKLKLTNVVFDTGGSKYHGRIAA
LAEAARERGLNF
Ligand information
>7p6z Chain 4 (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuggugcccaugucgcuguggaaacaccugguuccauuucgaacccagc
aguuaagcacaguggagccgaauguagcugcagugagaauaggaaagcac
caagc
<<<<<<<<.....<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<..<....<<<..>>>.....>.>>...>>>>
>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p6z Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		T3 R4 R9 H12 R20 M31 I33 K34 S35 L36 H38 W44 V51 S54 S96 H99 G100 R101
Binding residue
(residue number reindexed from 1)		T3 R4 R9 H12 R20 M31 I33 K34 S35 L36 H38 W44 V51 S54 S92 H95 G96 R97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p6z, PDBe:7p6z, PDBj:7p6z
PDBsum7p6z
PubMed36171285
UniProtQ50302|RL18_MYCPN Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]