Structure of PDB 5mei Chain n Binding Site BS02

Receptor Information

>5mei Chain n (length=156) Species: 559292 (Saccharomyces cerevisiae S288C)

SAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDK
PHMLKF

Ligand information

• Ligand ID: OHX
• InChI: InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6
• InChIKey: OWCQTVJQFLTQTE-UHFFFAOYSA-N
• SMILES:
  ACDLabs 12.01
  CACTVS 3.370
  OpenEye OEToolkits 1.7.0: N[Os](N)(N)(N)(N)N
• Formula: H12 N6 Os
• Name: osmium (III) hexammine;
  osmium(6+) hexaazanide
• PDB chain: 5mei Chain 1 Residue 3404

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5mei Inhibition of Eukaryotic Translation by the Antitumor Natural Product Agelastatin A.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): K29 L30
• Binding residue (residue number reindexed from 1): K28 L29
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5mei, PDBe:5mei, PDBj:5mei
• PDBsum: 5mei
• PubMed: 28457705
• UniProt: Q02326|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)