Structure of PDB 8d6y Chain m Binding Site BS02

Receptor Information
>8d6y Chain m (length=215) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELY
DRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLANVYAQTL
GTIFTEQAKPYEVELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMG
GTTEPIANALKESYAENASLTDALRIAVAALRALGVASLEVAVLDANRPR
RAFRRITGSALQALL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d6y The beta-Grasp Domain of Proteasomal ATPase Mpa Makes Critical Contacts with the Mycobacterium tuberculosis 20S Core Particle to Facilitate Degradation.
Resolution10.0 Å
Binding residue
(original residue number in PDB)
G23 R26 A27 K28 G66 K67 F68 N69 E119
Binding residue
(residue number reindexed from 1)
G16 R19 A20 K21 G59 K60 F61 N62 E112
Enzymatic activity
Enzyme Commision number 3.4.25.1: proteasome endopeptidase complex.
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
Biological Process
GO:0010498 proteasomal protein catabolic process
GO:0019941 modification-dependent protein catabolic process
GO:0030682 symbiont-mediated perturbation of host defenses
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0005737 cytoplasm
GO:0005839 proteasome core complex
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0019773 proteasome core complex, alpha-subunit complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8d6y, PDBe:8d6y, PDBj:8d6y
PDBsum8d6y
PubMed35993699
UniProtP9WHU1|PSA_MYCTU Proteasome subunit alpha (Gene Name=prcA)

[Back to BioLiP]