Structure of PDB 8d6y Chain m Binding Site BS02

Receptor Information

>8d6y Chain m (length=215) Species: 1773 (Mycobacterium tuberculosis)

SPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELY
DRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLANVYAQTL
GTIFTEQAKPYEVELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMG
GTTEPIANALKESYAENASLTDALRIAVAALRALGVASLEVAVLDANRPR
RAFRRITGSALQALL

Ligand information

>8d6y Chain j (length=4) Species: 1773 (Mycobacterium tuberculosis)

GQYL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8d6y The beta-Grasp Domain of Proteasomal ATPase Mpa Makes Critical Contacts with the Mycobacterium tuberculosis 20S Core Particle to Facilitate Degradation.
• Resolution: 10.0 Å
• Binding residue (original residue number in PDB): G23 R26 A27 K28 G66 K67 F68 N69 E119
• Binding residue (residue number reindexed from 1): G16 R19 A20 K21 G59 K60 F61 N62 E112

Enzymatic activity

• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004298 threonine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0010498 proteasomal protein catabolic process
• GO:0019941 modification-dependent protein catabolic process
• GO:0030682 symbiont-mediated perturbation of host defenses
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005737 cytoplasm
• GO:0005839 proteasome core complex
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall
• GO:0019773 proteasome core complex, alpha-subunit complex

External links

• PDB: RCSB:8d6y, PDBe:8d6y, PDBj:8d6y
• PDBsum: 8d6y
• PubMed: 35993699
• UniProt: P9WHU1|PSA_MYCTU Proteasome subunit alpha (Gene Name=prcA)