Structure of PDB 8cq7 Chain m Binding Site BS02

Receptor Information
>8cq7 Chain m (length=296) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQKEFRTSAYHSRFQTPFRRRQEGKTDYYQRKRLVTQHKAKYNSPKYRLV
VRFTNKDIIAQIVSAHITGDVVFTAAYAHELPRYGIKYGLTNWSAAYAVG
LLVARRALQKLGLDETYTGVEEVEGEFELTEAVEDGPRPFKVFLDIGLQR
TTTGARVFGVLKGASDGGLYVPHSPNRFPGWDIEAEELDAELLRKYIFGG
HVAEYMEELLDDDEEKYKSIFKNYIEEEIESEDVEEIYANAHEAIRADPS
FKPTEKKFTKEQYKAESKKYRQQKLTRAERQAKVAKKIAEFKAQQE
Ligand information
>8cq7 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuagcagaaagcaccguuccccguucgaucaaccgu
aguuaagcugcuaagagcaauaccgaguaguguagugggagaccauacgc
gaaacuauugugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cq7 Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R8 S10 H13 S14 F16 T18 F20 R21 R22 Q24 T28 Y30 R33 R50 V52 R54 T56 N57 Q63 I69 T70 G71 D72 V73 V74 Y79 G91 N94 W95 R152 T154 T155 G156 A157 R158 Y198 H203 Y207 K218 S221 I222 N225 F253 T256 F260 K262 Y265 K266 E268 S269 K270 Y272 Q274 K276 L277 R282 K285 K289
Binding residue
(residue number reindexed from 1)		R6 S8 H11 S12 F14 T16 F18 R19 R20 Q22 T26 Y28 R31 R48 V50 R52 T54 N55 Q61 I67 T68 G69 D70 V71 V72 Y77 G89 N92 W93 R150 T152 T153 G154 A155 R156 Y196 H201 Y205 K216 S219 I220 N223 F251 T254 F258 K260 Y263 K264 E266 S267 K268 Y270 Q272 K274 L275 R280 K283 K287
External links