Structure of PDB 8aaf Chain m Binding Site BS02

Receptor Information
>8aaf Chain m (length=294) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>8aaf Chain h (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8aaf Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
S13 S14 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R54 T56 N57 K58 D59 I61 Q63 I65 I69 D72 V74 Y79 H90 G91 N94 W95 R152 T155 G156 R158 Y198 H203 V204 Y207 E210 R218 E221 L222 K224 F253 T256 K258 F260 K262 Q264 Y265 A266 E268 S269 K270 Y272 Q274 T275 K276 L277 K279 R282 R285 V286 K289
Binding residue
(residue number reindexed from 1)
S10 S11 T15 F17 R18 R19 R21 K24 T25 Y27 R30 R51 T53 N54 K55 D56 I58 Q60 I62 I66 D69 V71 Y76 H87 G88 N91 W92 R149 T152 G153 R155 Y195 H200 V201 Y204 E207 R215 E218 L219 K221 F250 T253 K255 F257 K259 Q261 Y262 A263 E265 S266 K267 Y269 Q271 T272 K273 L274 K276 R279 R282 V283 K286
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8aaf, PDBe:8aaf, PDBj:8aaf
PDBsum8aaf
PubMed36804914
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]